DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and axin1

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_002935881.2 Gene:axin1 / 100498631 XenbaseID:XB-GENE-486781 Length:877 Species:Xenopus tropicalis


Alignment Length:249 Identity:68/249 - (27%)
Similarity:104/249 - (41%) Gaps:44/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VGGGGSLGGVSPTVGGSVGILGSTSNVLQESNATTFQRPQSQKPCCFCWCCCCSCSWAKCLAIKN 109
            :||..:.....|.|.|..|.|           .||.|||.|.           |....|...|||
 Frog    12 LGGSFTEDAPRPPVPGEEGEL-----------ITTDQRPFSH-----------SYYSLKNDGIKN 54

  Fly   110 ADENA-PTKRDLVNAEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWL 173
            ....| |.:.||......:|..........|.:|...|:....|..:|:.||:.|...:.:.||.
 Frog    55 ETSTATPRRPDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLQQENCADLLDFWF 119

  Fly   174 ACEDLKK-ENSPELVEEK---ARLIYEDYI----SILSPREV--SLDSRVREIVNRNMIEPTTHT 228
            ||...:| |.:...||::   |:.||:.||    .|:| |::  :..|.:::.|.|..|:|.  .
 Frog   120 ACSGFRKLEPNDSKVEKRLKLAKAIYKKYILDSNGIVS-RQIKPATKSFIKDCVLRQQIDPA--M 181

  Fly   229 FDEAQIQIYTLMHRDSYPRFLNSQ---KFKTLA-----QLQDNSNAGSKADSPT 274
            ||:||.:|.::|..::||.||.|.   ::.|:.     ...|.|:|......|:
 Frog   182 FDQAQTEIQSMMEDNTYPVFLKSDTYLEYTTIGGESPKNYSDQSSASGTGKGPS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 40/129 (31%)
axin1XP_002935881.2 Axin_TNKS_binding 11..80 CDD:211424 23/89 (26%)
RGS_Axin 89..209 CDD:188662 38/122 (31%)
Axin_b-cat_bind 467..503 CDD:400956
DIX 797..874 CDD:395628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.