DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs6

DIOPT Version :10

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_004917305.1 Gene:rgs6 / 100486845 XenbaseID:XB-GENE-954519 Length:489 Species:Xenopus tropicalis


Alignment Length:139 Identity:53/139 - (38%)
Similarity:86/139 - (61%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 FLD---GEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKE---NS 183
            |||   .::|:.:.::.||.|.|:::|...||:.|..||.||||.||:.||:..:||||:   ..
 Frog   315 FLDLENSKEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEV 379

  Fly   184 PELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRF 248
            |:.|||    |::::::..:...::|||...|..::|:.:|..:||::||..||.||..|||.||
 Frog   380 PKRVEE----IWQEFLAPGAQSAINLDSHSFEKTSQNVKDPGRYTFEDAQEHIYKLMKSDSYARF 440

  Fly   249 LNSQKFKTL 257
            |.|..::.|
 Frog   441 LRSNAYQDL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 48/119 (40%)
rgs6XP_004917305.1 DEP_RGS7-like 30..118 CDD:239897
RGS_DHEX 115..216 CDD:375589
GGL 257..318 CDD:128520 2/2 (100%)
RGS_RGS6 327..451 CDD:188691 49/127 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.