DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs3

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_002941346.1 Gene:rgs3 / 100486204 XenbaseID:XB-GENE-5900212 Length:330 Species:Xenopus tropicalis


Alignment Length:128 Identity:63/128 - (49%)
Similarity:94/128 - (73%) Gaps:0/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLI 194
            :|:::::.|||||.:.|:..|.||.:|:.||:||||:||:.||||||:.|..:...::..:||.|
 Frog   195 RPSIDDVTSWGKSLENLLSHTYGRALFRVFLQSEFSDENLDFWLACEEYKDTHPNFILHSRARKI 259

  Fly   195 YEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257
            |:.||::.||:||:||:..||:...|::.||..||||||.:||.||.||||||||.|..:::|
 Frog   260 YQLYIALQSPKEVNLDASTREMTEHNLLIPTRTTFDEAQRRIYGLMERDSYPRFLRSDLYQSL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 60/116 (52%)
rgs3XP_002941346.1 RGS_RGS3 208..321 CDD:188668 56/112 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.