DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and axin2

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_002935041.1 Gene:axin2 / 100380149 XenbaseID:XB-GENE-6449828 Length:707 Species:Xenopus tropicalis


Alignment Length:141 Identity:41/141 - (29%)
Similarity:66/141 - (46%) Gaps:15/141 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 WGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEK-ARLIYEDYI--- 199
            ||:|.:.|:....|..:|:.:|..|...:.:.||.||...:..:..|....| |:.||..|:   
 Frog    69 WGRSLNLLLDDQDGATLFRMYLEGEGLVDLLSFWFACNGFRAMDPLEPKTSKTAKAIYRWYVQNS 133

  Fly   200 SILSPR-EVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQLQDN 263
            |.:|.| :.|..::|:|.|....:..|  .||:||.:|...|.::::..||.|...|..|:    
 Frog   134 SAVSCRLKPSTRTQVKECVKNQQLNKT--VFDQAQQEIQRAMEQEAFTSFLQSDICKEYAR---- 192

  Fly   264 SNAGSKADSPT 274
                ...||||
 Frog   193 ----GVEDSPT 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 35/121 (29%)
axin2XP_002935041.1 RGS_Axin 73..189 CDD:188662 32/117 (27%)
Axin_b-cat_bind 383..426 CDD:370146
DIX 630..702 CDD:366298
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.