DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and Rgs21

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001273951.1 Gene:Rgs21 / 100361166 RGDID:2320695 Length:152 Species:Rattus norvegicus


Alignment Length:131 Identity:60/131 - (45%)
Similarity:89/131 - (67%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 PTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIY 195
            ||.|.: :|.::.|.|:.:.||...|:.||:|||||||:.|||||||.||....|.:..||::||
  Rat    11 PTTETL-AWSENMDSLLANQAGLDAFRTFLKSEFSEENVEFWLACEDFKKTECREKIATKAKMIY 74

  Fly   196 EDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLAQL 260
            .::|...:|:|:::|...|::::||:.|||...|||||..||:||.:||:||||.|:.:|.....
  Rat    75 SEFIVADAPKEINIDFSTRDLISRNIAEPTPKCFDEAQKLIYSLMAKDSFPRFLKSEIYKKFINT 139

  Fly   261 Q 261
            |
  Rat   140 Q 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 55/116 (47%)
Rgs21NP_001273951.1 RGS 25..135 CDD:295367 53/109 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.