DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs20

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001121502.1 Gene:rgs20 / 100158614 XenbaseID:XB-GENE-976969 Length:218 Species:Xenopus tropicalis


Alignment Length:211 Identity:123/211 - (58%)
Similarity:154/211 - (72%) Gaps:18/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NVLQES-NATTFQR---PQSQKPCCFCWCCCCSCSWAKCLAIKNADENAPTKRD--------LVN 122
            :|.||: :||..|:   .:....||||||||||||   ||.::|.|:.. |:|.        :.|
 Frog    14 SVHQEAVSATQAQQGVGNRGSNACCFCWCCCCSCS---CLTVRNQDDER-TRRSSNEIRGHGIPN 74

  Fly   123 AEFLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELV 187
            .|  :...||||::.|||:||||||.:.|||..|:.|||:||||||:|||:|||:||||.|..::
 Frog    75 WE--ESPSPTLEDVYSWGQSFDKLMTTPAGRNAFREFLRTEFSEENMLFWMACEELKKEASKNVI 137

  Fly   188 EEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQ 252
            |||||||||||||||||:||||||||||::||||:||:..|||:||:||||||||||||||:||.
 Frog   138 EEKARLIYEDYISILSPKEVSLDSRVREVINRNMLEPSQRTFDDAQLQIYTLMHRDSYPRFMNSA 202

  Fly   253 KFKTLAQLQDNSNAGS 268
            .:|.|.|....|.|.|
 Frog   203 IYKNLLQTLSESPADS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 86/116 (74%)
rgs20NP_001121502.1 RGS_RGS20 46..206 CDD:188700 102/165 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 183 1.000 Domainoid score I3375
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I3248
OMA 1 1.010 - - QHG47786
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 1 1.000 - - otm49145
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3135
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.