DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhit and rgs19

DIOPT Version :9

Sequence 1:NP_611271.3 Gene:Dhit / 37037 FlyBaseID:FBgn0028743 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001120125.1 Gene:rgs19 / 100145150 XenbaseID:XB-GENE-5736048 Length:220 Species:Xenopus tropicalis


Alignment Length:211 Identity:123/211 - (58%)
Similarity:151/211 - (71%) Gaps:23/211 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LQESNATTFQRPQSQK-----PCCFCWCCCCSCSWAKCLAIKNADEN------APTKRDLV-NAE 124
            |.||..:.:.|.|..:     ||||||||||||||       |.|.|      ..||.::| :.|
 Frog    21 LSESPMSRYDRNQPTRNHRSNPCCFCWCCCCSCSW-------NEDRNRRRRLSRDTKLEIVPHCE 78

  Fly   125 FLDGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEE 189
            ..  .:|:.||||||..||:|||||.|||.||:.|||:|:||||:|||||||:||||.....|||
 Frog    79 VC--SKPSSEEIRSWAGSFEKLMKSPAGRNVFREFLRTEYSEENMLFWLACEELKKEYCRPSVEE 141

  Fly   190 KARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKF 254
            |||.|||||||||||:||||||||||::||.|.:|:.||||:||:||||||||||:||||||..:
 Frog   142 KARGIYEDYISILSPKEVSLDSRVREMINRRMQDPSPHTFDDAQLQIYTLMHRDSFPRFLNSGIY 206

  Fly   255 KTLAQLQDNSNAGSKA 270
            |:|  ||:.|.:.|::
 Frog   207 KSL--LQNISRSSSES 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhitNP_611271.3 RGS_RZ-like 139..256 CDD:188673 85/116 (73%)
rgs19NP_001120125.1 RGS 91..208 CDD:295367 85/116 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 183 1.000 Domainoid score I3375
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I3248
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1409647at2759
OrthoFinder 1 1.000 - - FOG0000119
OrthoInspector 1 1.000 - - otm49145
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.