DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and RAD6

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_011457.1 Gene:RAD6 / 852822 SGDID:S000003026 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:160 Identity:47/160 - (29%)
Similarity:77/160 - (48%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAPRRLRKELSDLQGNALKSFRDIKAD----------DDNLLRWTGLIV-PDNPPYNKGAFRIE 54
            |:.|.|.|         .::.|:.:|.|          .||::.|..:|: |.:.||..|.||:.
Yeast     1 MSTPARRR---------LMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLL 56

  Fly    55 INFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEH 119
            :.|..|||.|||.:.|.:.::|||:...|::||.|:. ..|.|......::.::..|.|||.|..
Yeast    57 LEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPAS 120

  Fly   120 PLRAELAEEFLKDRKKFVKNAEDYTKKHSE 149
            |...|.|..|...:.::||..::..:|..|
Yeast   121 PANVEAATLFKDHKSQYVKRVKETVEKSWE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 43/148 (29%)
RAD6NP_011457.1 COG5078 1..150 CDD:227410 46/158 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.