DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and UBC30

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_851198.1 Gene:UBC30 / 835714 AraportID:AT5G56150 Length:148 Species:Arabidopsis thaliana


Alignment Length:147 Identity:57/147 - (38%)
Similarity:89/147 - (60%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIV-PDNPPYNKGAFRIEINFPAEYPFKPP 66
            |.:|:.|||.|||.:...|.......|| :.:|...|: |.:.|:..|.|.:.|:||.:||||||
plant     2 ASKRINKELRDLQRDPPVSCSAGPTGDD-MFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPP 65

  Fly    67 KINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLK 131
            |:.|:|::|||||:..|.:||.|:. |.|.||....:|:.::..|:.||.|:.||..|:|..:..
plant    66 KVAFRTKVYHPNINSNGSICLDILK-EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYKT 129

  Fly   132 DRKKFVKNAEDYTKKHS 148
            ||.|:...|:.:|:|::
plant   130 DRVKYESTAQSWTQKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 54/138 (39%)
UBC30NP_851198.1 UBCc 1..146 CDD:412187 57/145 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.