DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and Ube2d4

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_112263.1 Gene:Ube2d4 / 79435 RGDID:69425 Length:147 Species:Rattus norvegicus


Alignment Length:153 Identity:58/153 - (37%)
Similarity:93/153 - (60%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APRRLRKELSDLQGNALKSFRDIKAD------DDNLLRWTGLIV-PDNPPYNKGAFRIEINFPAE 60
            |.:|:.|||:||.       :|..|.      .:::..|...|: |::.||..|||.:.|:||.|
  Rat     2 ALKRIHKELNDLA-------QDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTE 59

  Fly    61 YPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAEL 125
            |||||||:.|.|||||||::..|.:||.|:.:: |.||....:|:.::..|:.||.|:.||..|:
  Rat    60 YPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQ-WSPALTISKVLLSISSLLCDPNPDDPLVPEI 123

  Fly   126 AEEFLKDRKKFVKNAEDYTKKHS 148
            |:.:..||.|:.:.|.::|:|::
  Rat   124 AQIYKTDRDKYNRTAREWTQKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 55/144 (38%)
Ube2d4NP_112263.1 UBCc 1..146 CDD:412187 58/151 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.