DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and UBE2L3

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001243284.1 Gene:UBE2L3 / 7332 HGNCID:12488 Length:212 Species:Homo sapiens


Alignment Length:146 Identity:108/146 - (73%)
Similarity:131/146 - (89%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKPPKINFKTR 73
            :||.:::...:|:||:|:.|:.|||.|.||||||||||:|||||||||||||||||||||.|||:
Human    67 EELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTK 131

  Fly    74 IYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVK 138
            |||||||||||||||:||.|||||||:||||:|:|:.|:|||:|||||||:||||:.||||||.|
Human   132 IYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCK 196

  Fly   139 NAEDYTKKHSEKRPAD 154
            |||::|||:.||||.|
Human   197 NAEEFTKKYGEKRPVD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 100/134 (75%)
UBE2L3NP_001243284.1 COG5078 67..208 CDD:227410 103/140 (74%)
UBCc 67..207 CDD:214562 103/139 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 232 1.000 Domainoid score I2425
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3195
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51868
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 1 1.000 - - otm41830
orthoMCL 1 0.900 - - OOG6_106294
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3871
SonicParanoid 1 1.000 - - X2225
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.