DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and ube2e2

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001003494.1 Gene:ube2e2 / 445100 ZFINID:ZDB-GENE-040801-237 Length:201 Species:Danio rerio


Alignment Length:150 Identity:52/150 - (34%)
Similarity:88/150 - (58%) Gaps:7/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TAPRRLRKELSDLQGNALKSFRDIKA--DDDNLLRWTGLIV-PDNPPYNKGAFRIEINFPAEYPF 63
            |:.:|::|||:::   .|....:..|  ..||:..|...|: |....|..|.|.::|.|..:|||
Zfish    55 TSAKRIQKELAEI---TLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIAFTPDYPF 116

  Fly    64 KPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEE 128
            ||||:.|:|||||.||:.:|.:||.|:. :||.||....:|:.::..|:.|..|..||...:|.:
Zfish   117 KPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ 180

  Fly   129 FLKDRKKFVKNAEDYTKKHS 148
            :|.:|.:..:.|:.:||:::
Zfish   181 YLTNRTEHDRIAKQWTKRYA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 49/140 (35%)
ube2e2NP_001003494.1 UQ_con 59..196 CDD:395127 49/140 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.