DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and ube2l3a

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001002072.1 Gene:ube2l3a / 415162 ZFINID:ZDB-GENE-030131-2977 Length:154 Species:Danio rerio


Alignment Length:154 Identity:113/154 - (73%)
Similarity:136/154 - (88%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKP 65
            |.|.|||.|||.:::.:.:|:||:|:.|:.|:|.|.||||||||||:||||||||.|||||||||
Zfish     1 MAASRRLHKELDEIRKSGMKNFRNIQVDESNILTWQGLIVPDNPPYDKGAFRIEITFPAEYPFKP 65

  Fly    66 PKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFL 130
            |||.|||:|||||||||||||||:||.|||||||:||||:|:|:.|:|||:|||||||:||||:.
Zfish    66 PKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYS 130

  Fly   131 KDRKKFVKNAEDYTKKHSEKRPAD 154
            ||||||.||||::||||.||||.|
Zfish   131 KDRKKFFKNAEEFTKKHGEKRPVD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 101/137 (74%)
ube2l3aNP_001002072.1 UQ_con 6..144 CDD:306648 101/137 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2386
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133056
Inparanoid 1 1.050 256 1.000 Inparanoid score I3145
OMA 1 1.010 - - QHG51868
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 1 1.000 - - otm24909
orthoMCL 1 0.900 - - OOG6_106294
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2225
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.