DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and Uev1A

DIOPT Version :10

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_647959.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:80 Identity:24/80 - (30%)
Similarity:38/80 - (47%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAPR--RLRKELSDLQ---GNALKSFRDIKADDDNLLRWTGLIV-PDNPPYNKGAFRIEINFPA 59
            :..||  ||.:||...|   |:...|:.....||..|..|.|:|: |...|:....:.::|....
  Fly     9 VVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGE 73

  Fly    60 EYPFKPPKINFKTRI 74
            .||.:||.:.|.|::
  Fly    74 RYPDEPPTLRFITKV 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UBCc_UBE2L3 3..149 CDD:467421 24/78 (31%)
Uev1ANP_647959.1 UEV_UBE2V 9..142 CDD:467427 24/80 (30%)

Return to query results.
Submit another query.