DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and CG10862

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:147 Identity:54/147 - (36%)
Similarity:83/147 - (56%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RLRKELSDLQGNALKSFRDIKAD--DDNLLRWTGLIV-PDNPPYNKGAFRIEINFPAEYPFKPPK 67
            |||:|:|:...:..:.   .||:  .|||..|...|. |....|..|.||:||.||..|||.||.
  Fly   212 RLRREISEFSTDQTEG---CKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPY 273

  Fly    68 INFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKD 132
            :.|.|:.||.||...|::||.|:.:: |.||....:|:.:::.|:.||.|..|:...:|:.|..:
  Fly   274 LAFLTKTYHCNIALSGRICLDILGSK-WSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGN 337

  Fly   133 RKKFVKNAEDYTKKHSE 149
            |....|||.::|||:::
  Fly   338 RALHDKNAREWTKKYAK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 51/140 (36%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 54/145 (37%)
UQ_con 212..349 CDD:278603 51/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.