DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and CG5440

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster


Alignment Length:149 Identity:53/149 - (35%)
Similarity:88/149 - (59%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIV-PDNPPYNKGAFRIEINFPAEYPFKP 65
            :|.:|::|||.::..:. ..:......:|||..||..|: |.:..|..|.|:::|.||.||||.|
  Fly    21 SAVKRIQKELDEITRDP-PQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPFAP 84

  Fly    66 PKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFL 130
            |.:.|:|.|||.||...|.:||.|:. |.|.||....:::.::..|:.|..|:.||.|::..|:|
  Fly    85 PVVIFRTPIYHCNIHRLGFICLDILK-EKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEYL 148

  Fly   131 KDRKKFVKNAEDYTKKHSE 149
            |:|.:..|.|..:||::::
  Fly   149 KNRAEHDKKARLWTKRYAK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 50/138 (36%)
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 53/149 (36%)
UQ_con 25..162 CDD:278603 50/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.