DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and ben

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster


Alignment Length:147 Identity:48/147 - (32%)
Similarity:87/147 - (59%) Gaps:5/147 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIV--PDNPPYNKGAFRIEINFPAEYPFKPP 66
            |||:.||...|....:.....|  .|:|..|:..:||  |::.|:..|.|::|:..|.:||...|
  Fly     5 PRRIIKETQRLMQEPVPGINAI--PDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAP 67

  Fly    67 KINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLK 131
            |:.|.|:|||||||..|::||.::. :.|.||.:...::.::..|::.|.|:.||..::||.:..
  Fly    68 KVRFITKIYHPNIDRLGRICLDVLK-DKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKV 131

  Fly   132 DRKKFVKNAEDYTKKHS 148
            :..:.::||.::|:|::
  Fly   132 NEAEAIRNAREWTQKYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 44/139 (32%)
benNP_001162752.1 UBCc 3..149 CDD:412187 48/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.