DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and ube2l3b

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001076266.1 Gene:ube2l3b / 321943 ZFINID:ZDB-GENE-030131-662 Length:190 Species:Danio rerio


Alignment Length:145 Identity:107/145 - (73%)
Similarity:130/145 - (89%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKPPKINFKTRI 74
            ||.:::.:.:|:||:|:.|:.|:|.|.||||||||||:||||||||.||||||||||||.|||:|
Zfish    46 ELEEIRKSGMKNFRNIQVDESNILTWQGLIVPDNPPYDKGAFRIEIIFPAEYPFKPPKITFKTKI 110

  Fly    75 YHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVKN 139
            ||||||||||||||:||.|||||||:||||:|:|:.|:|||:|||||||:||||:.||||||.||
Zfish   111 YHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKN 175

  Fly   140 AEDYTKKHSEKRPAD 154
            ||::||||.||||.|
Zfish   176 AEEFTKKHGEKRPVD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 98/133 (74%)
ube2l3bNP_001076266.1 COG5078 44..186 CDD:227410 102/139 (73%)
UBCc 46..185 CDD:214562 102/138 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 230 1.000 Domainoid score I2386
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I3145
OMA 1 1.010 - - QHG51868
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 1 1.000 - - otm24909
orthoMCL 1 0.900 - - OOG6_106294
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3871
SonicParanoid 1 1.000 - - X2225
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.