DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and UbcE2H

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster


Alignment Length:110 Identity:36/110 - (32%)
Similarity:59/110 - (53%) Gaps:3/110 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PDNPPYNKGAFRIEINFPAEYPFKPPKINFKTRIYHPNIDE-KGQVCLPIISTENWKPATRTDQV 104
            |...||..|.:::.:..|..||||.|.|.|..:|||||||| .|.|||.:|: :.|........:
  Fly    41 PTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVIN-QAWTALYDLSNI 104

  Fly   105 VQA-LVDLINDPEPEHPLRAELAEEFLKDRKKFVKNAEDYTKKHS 148
            .:: |..|:..|.|..||..:.|..:|.:.:::.:...||.::::
  Fly   105 FESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYA 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 35/104 (34%)
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.