DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and ube2ib

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_571426.1 Gene:ube2ib / 30622 ZFINID:ZDB-GENE-990614-17 Length:158 Species:Danio rerio


Alignment Length:121 Identity:37/121 - (30%)
Similarity:65/121 - (53%) Gaps:4/121 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NLLRWTGLIVP--DNPPYNKGAFRIEINFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTE 93
            ||:.|. ..:|  ...|:..|.|::.:.|..:||..|||..|:..::|||:...|.|||.|:..:
Zfish    37 NLMNWE-CAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEED 100

  Fly    94 -NWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVKNAEDYTKKHS 148
             :|:||....|::..:.:|:|:|..:.|.:||....:.::|.::.|......||.|
Zfish   101 KDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 34/115 (30%)
ube2ibNP_571426.1 COG5078 1..156 CDD:227410 36/119 (30%)
UQ_con 8..152 CDD:278603 34/115 (30%)
Interaction with SUMO1. /evidence=ECO:0000250 13..18
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.