DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and Ube2l6

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001019926.1 Gene:Ube2l6 / 295704 RGDID:1307960 Length:153 Species:Rattus norvegicus


Alignment Length:153 Identity:74/153 - (48%)
Similarity:100/153 - (65%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKP 65
            |||.:|:.|||.||........|.:.:||.|:|.|..|::||..||...||.:.|:||.|||.||
  Rat     1 MTASKRVAKELDDLSKELPPYLRHLSSDDANVLVWHMLLLPDQLPYRLKAFGLRIDFPREYPLKP 65

  Fly    66 PKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFL 130
            |.:.|.|:||||||.|.|.||||:||||||||.|:..||::||..|::.|..|.|:|.|||:...
  Rat    66 PTLRFTTKIYHPNISEDGLVCLPLISTENWKPYTKAYQVLEALNILVSRPNLEEPVRLELADLLT 130

  Fly   131 KDRKKFVKNAEDYTKKHSEKRPA 153
            :|.:.|.|.||::|.::...||:
  Rat   131 QDPEMFRKKAEEFTLQYGVDRPS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 68/137 (50%)
Ube2l6NP_001019926.1 COG5078 1..147 CDD:227410 72/145 (50%)
UQ_con 6..144 CDD:278603 68/137 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336860
Domainoid 1 1.000 141 1.000 Domainoid score I4602
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4246
OMA 1 1.010 - - QHG51868
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 1 1.000 - - otm45821
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2225
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.