DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and Ube2dnl1

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001263325.1 Gene:Ube2dnl1 / 237009 MGIID:3646570 Length:155 Species:Mus musculus


Alignment Length:118 Identity:45/118 - (38%)
Similarity:77/118 - (65%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DNLLRWTGLIV-PDNPPYNKGAFRIEINFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTE 93
            :|:..|...|: |::.||..|.|.:.|:||..|||||||::|.||||||||.:.|.:||.|::::
Mouse    36 ENMFHWQATIMGPEDSPYQGGVFFLSIHFPNNYPFKPPKVSFITRIYHPNISKNGSICLDILNSK 100

  Fly    94 NWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVKNAEDYTKK 146
             |.|.....:|:.::..|:.||..:.||..|:|:.:.||.:::.:.|.::|::
Mouse   101 -WSPTLTISKVLLSICSLLCDPNADDPLVPEIAKVYHKDLREYNRLAREWTER 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 44/114 (39%)
Ube2dnl1NP_001263325.1 COG5078 9..155 CDD:227410 45/118 (38%)
UBCc 9..154 CDD:294101 45/118 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.