DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and Ube2l3

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_033482.1 Gene:Ube2l3 / 22195 MGIID:109240 Length:154 Species:Mus musculus


Alignment Length:154 Identity:114/154 - (74%)
Similarity:136/154 - (88%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKP 65
            |.|.|||.|||.:::...:|:||:|:.|:.|||.|.||||||||||:||||||||||||||||||
Mouse     1 MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKP 65

  Fly    66 PKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFL 130
            |||.|||:|||||||||||||||:||.|||||||:||||:|:|:.|:|||:|||||||:||||:.
Mouse    66 PKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYS 130

  Fly   131 KDRKKFVKNAEDYTKKHSEKRPAD 154
            ||||||.||||::|||:.||||.|
Mouse   131 KDRKKFCKNAEEFTKKYGEKRPVD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 103/137 (75%)
Ube2l3NP_033482.1 UBCc 6..149 CDD:214562 106/142 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 232 1.000 Domainoid score I2408
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3180
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51868
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 1 1.000 - - oto94506
orthoMCL 1 0.900 - - OOG6_106294
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3871
SonicParanoid 1 1.000 - - X2225
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.