DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and ubc-7

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_499133.1 Gene:ubc-7 / 176363 WormBaseID:WBGene00006704 Length:164 Species:Caenorhabditis elegans


Alignment Length:157 Identity:43/157 - (27%)
Similarity:83/157 - (52%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRKELSDLQGNALKSFRDIKADDDNLLRWTGLIV-PDNPPYNKGAFRIEINFPAEYPFKPPKINF 70
            |:|:|:|::...:..|.....||:::.:|..|:: |.:..|..|.|:..::||.:||.||||:.|
 Worm     8 LKKQLADMRRVPVDGFSAGLVDDNDIYKWEVLVIGPPDTLYEGGFFKAILDFPRDYPQKPPKMKF 72

  Fly    71 KTRIYHPNIDEKGQVCLPII------------STENWKPATRTDQVVQALVDLINDPEPEHPLRA 123
            .:.|:|||||::|.||:.|:            ..|.|.|....:.::.:::.::.||..|.|...
 Worm    73 ISEIWHPNIDKEGNVCISILHDPGDDKWGYERPEERWLPVHTVETILLSVISMLTDPNFESPANV 137

  Fly   124 ELAEEFLKDRKKFVKNAEDYTKKHSEK 150
            :.|:...::..:|.|......::..|:
 Worm   138 DAAKMQRENYAEFKKKVAQCVRRSQEE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 42/149 (28%)
ubc-7NP_499133.1 COG5078 8..161 CDD:227410 42/152 (28%)
UQ_con 8..158 CDD:278603 42/149 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.