DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and UBE2L5

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001342176.1 Gene:UBE2L5 / 171222 HGNCID:13477 Length:154 Species:Homo sapiens


Alignment Length:154 Identity:112/154 - (72%)
Similarity:135/154 - (87%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKP 65
            |.|.|||.|||.:::...:::||:|:.|:.|||.|.|||||||||||||||||||||||||||||
Human     1 MAASRRLMKELEEIRKCGMENFRNIQVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKP 65

  Fly    66 PKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFL 130
            |:|.|||:|||||||||||||||:||.|||||||:||||:|:|:.|:|||:|||||||:||||:.
Human    66 PRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYS 130

  Fly   131 KDRKKFVKNAEDYTKKHSEKRPAD 154
            .|||||.||||::|||:.||||.|
Human   131 NDRKKFCKNAEEFTKKYGEKRPVD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 101/137 (74%)
UBE2L5NP_001342176.1 UBCc 6..149 CDD:214562 104/142 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 232 1.000 Domainoid score I2425
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3195
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51868
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 1 1.000 - - otm41830
orthoMCL 1 0.900 - - OOG6_106294
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2225
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.