DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc10 and Gm10145

DIOPT Version :9

Sequence 1:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_036012045.1 Gene:Gm10145 / 100040961 MGIID:3704353 Length:154 Species:Mus musculus


Alignment Length:154 Identity:113/154 - (73%)
Similarity:135/154 - (87%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKP 65
            |.|.|||.|||.:::...:|:||:|:.|:.|||.|.||||||||||:||||||||||||||||||
Mouse     1 MAASRRLMKELEEIRKRGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKP 65

  Fly    66 PKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFL 130
            |||.|||:|||||||||||||||:||.||||.||:||||:|:|:.|:|||:|||||||:||||:.
Mouse    66 PKITFKTKIYHPNIDEKGQVCLPVISAENWKLATKTDQVIQSLIALVNDPQPEHPLRADLAEEYS 130

  Fly   131 KDRKKFVKNAEDYTKKHSEKRPAD 154
            ||||||.||||::|||:.||||.|
Mouse   131 KDRKKFCKNAEEFTKKYGEKRPVD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 102/137 (74%)
Gm10145XP_036012045.1 UBCc 6..149 CDD:214562 105/142 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133056
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.