DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aft and CG6379

DIOPT Version :9

Sequence 1:NP_477413.1 Gene:aft / 37034 FlyBaseID:FBgn0026309 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001284851.1 Gene:CG6379 / 31355 FlyBaseID:FBgn0029693 Length:788 Species:Drosophila melanogaster


Alignment Length:325 Identity:75/325 - (23%)
Similarity:127/325 - (39%) Gaps:73/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TNRRDPSGEVSWRLKNDTKAEFVTVAWCKLFECLHRYPLVTKPAVNSMHLCEAPGAFIASLNHYL 153
            ||.|||:|:.   |....:..:.|                        .:|..||.|    :.|:
  Fly   192 TNPRDPAGQT---LVAPDELLYFT------------------------DMCAGPGGF----SEYV 225

  Fly   154 HSKYEKDEIKWRWRSTTLNPYYEGNAINQMISDDRFIV--HTLDNWFFHKDLTGNLLDVANIDHL 216
              .|.|.     |.:........|  .|....:..|..  .:.|.::..|: .||:.|.:|.|.|
  Fly   226 --LYRKS-----WEAKGFGFTLRG--ANDFKLEKFFAASPESFDTFYGVKE-DGNIFDESNQDSL 280

  Fly   217 VERCEVEFQGQVDLVTADGSIDCAAQPDCQEEIVVRLFFAEVLSALRILSSGGNFLVKMFTLFEA 281
            .|...:.....|....|||......|.:.||.:..:|:..:.|:||:||...|:|:.|:|.||..
  Fly   281 NEYIRMHTPQGVHFAMADGGFSVEGQKNIQEILSKQLYLCQFLTALKILRPNGSFVCKVFDLFTP 345

  Fly   282 CSVSLLYTLNCIFEEVHIFKPATSKRGNSEVYVICLNYNKDHPDLPRLLEEIK------SKLAQP 340
            .||.|:|.:...|:::.|.||.:|:..|||.|::| .|.:...:...::..:.      |..:|.
  Fly   346 FSVGLVYLMYKCFQQIAIIKPNSSRPANSERYLVC-KYKRSDAETAGIVAYLNTVNLMLSDESQL 409

  Fly   341 NDTLVMPLFAKFQI--PHDFLMQHEIACRMYMKLQTDAIEGSIYAYESNDRHYLRHLHHLRSLVA 403
            ::..|:.:|...::  ..|||.                     |..:||:....:.:..||.:.|
  Fly   410 DENDVLEIFNANELAEDEDFLR---------------------YIIDSNNAIGKKQIVGLRKIAA 453

  Fly   404  403
              Fly   454  453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aftNP_477413.1 FtsJ 110..319 CDD:279986 54/210 (26%)
CG6379NP_001284851.1 G-patch 25..69 CDD:279867
FtsJ 172..383 CDD:279986 61/232 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16121
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.