DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and Pip4k2b

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_446002.1 Gene:Pip4k2b / 89812 RGDID:621710 Length:416 Species:Rattus norvegicus


Alignment Length:289 Identity:69/289 - (23%)
Similarity:112/289 - (38%) Gaps:82/289 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1576 GKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQQQQQPTLLAKIFGVFRVSVKKK 1640
            |:.|:||..|.|.|||:|.::|.|:........||.::|..|...   |||.:..|::|::|   
  Rat   133 GRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGN---TLLPQFLGMYRLTV--- 191

  Fly  1641 DSFVERSVMVMENLF-YGCNIENKFDLKGSERNRLVDPSNQQGEIVLLDENLVQMSWSKPLYVLS 1704
             ..||..::|..|:| :...:..|:|||||...|......:..::....:|.. ::..:.|.|..
  Rat   192 -DGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKDNDF-LNEGQKLRVGE 254

  Fly  1705 HSKTVLRDAIQRDSSFLEKNLVMDYSLLVGL--------------DK------------------ 1737
            .||....:.::||..||.:..:||||||||:              |:                  
  Rat   255 ESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEETEVEDRAEEEECENDGVGGGLLCS 319

  Fly  1738 ---------------------------------------KNGVLVLGIIDYIRTFTLDKRVESII 1763
                                                   |..|..:.|||.:..:...|:.....
  Rat   320 YGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESAPKKEVYFMAIIDILTPYDAKKKAAHAA 384

  Fly  1764 KGSGILGGKGKDPTVVNPERYKQRFIDAM 1792
            |  .:..|.|.:.:.||||:|.:||.:.|
  Rat   385 K--TVKHGAGAEISTVNPEQYSKRFNEFM 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 69/289 (24%)
Pip4k2bNP_446002.1 PIPKc 39..416 CDD:238081 69/289 (24%)
Required for interaction with PIP5K1A. /evidence=ECO:0000250|UniProtKB:Q8TBX8 64..70
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.