DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and PIB2

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_011492.3 Gene:PIB2 / 852861 SGDID:S000002991 Length:635 Species:Saccharomyces cerevisiae


Alignment Length:362 Identity:79/362 - (21%)
Similarity:135/362 - (37%) Gaps:117/362 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TSNNQN-NSSSHQHLHSPSKLTEFARNFEDKPESLF-GRVVNKIQNVYNQSYNTVND------IS 58
            :|.|.| ||:.|:         ...|...:..:.|: ..|:.|:...     |..||      :|
Yeast   309 SSTNLNFNSNKHK---------SNVRQISNPKKPLYIPAVLRKVSET-----NITNDDLLNATLS 359

  Fly    59 SGSSSSSSTQPVQVVGKSQFFSDSQTSTAEIADVET----SSQSSVRPQPPTTLSIRTNSETRGT 119
            |....:|:.:        ..|:.|::.:|.:.:...    ||||||:                  
Yeast   360 SYYKKASNLE--------HGFNPSKSQSASVQNANNLRIISSQSSVQ------------------ 398

  Fly   120 STSSNTAAEDSETSDRVETLPLPTSEANQGRTVSNVLKHISNIVATKNNNDLRNYKDTELQRFWM 184
               |||::......:::.:...|.|..|..|.  |::..|||..:.:.|...:::        |:
Yeast   399 ---SNTSSILESYKNKISSYLFPNSIPNSDRI--NLIPTISNRNSARVNPPTKDH--------WI 450

  Fly   185 PDSKAKECYDCSQKFSTFRRKHHCRLCGQIFCSK---------------CCNQVVPGMIIRCDGD 234
            ||||...|..|.:.|:.:.||||||.||.|||..               ..|::..|.|   :|.
Yeast   451 PDSKRNSCRYCHKPFTLWERKHHCRHCGDIFCQDHLRHWLYLDSQANFIMINELNNGGI---NGG 512

  Fly   235 LKVCNYCSKIVLTFLKSSSS-------------EMGQD-----MQELQQHLSNK----LEVQDSG 277
            ..:|..|...::.:...|::             |.|:|     .::|:.:..|:    |.....|
Yeast   513 GTLCKICDDCLVEYENLSTTNHNANTNEDNINVEEGEDDDNDNRKKLRNYYKNRQMNALFRPKKG 577

  Fly   278 SSLAKHPQMQR---APLPRKT---------SVGYQEE 302
            .|..:|..:.|   .|:..|:         :.|.|||
Yeast   578 GSSQEHATVDRDTTTPIQVKSNDEEADNENTGGEQEE 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264 25/75 (33%)
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374
PIB2NP_011492.3 FYVE 446..530 CDD:214499 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2108
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.