DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and PIP4K2B

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:XP_011523628.1 Gene:PIP4K2B / 8396 HGNCID:8998 Length:443 Species:Homo sapiens


Alignment Length:313 Identity:68/313 - (21%)
Similarity:113/313 - (36%) Gaps:103/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1576 GKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFE---------------------YIDRCQ- 1618
            |:.|:||..|.|.|||:|.::|.|:........||.:                     :..||: 
Human   133 GRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQMAGSLACLCILSLPCGIPISGWQKRCKF 197

  Fly  1619 --QQQQPTLLAKIFGVFRVSVKKKDSFVERSVMVMENLF-YGCNIENKFDLKGSERNRLVDPSNQ 1680
              :....|||.:..|::|::|    ..||..::|..|:| :...:..|:|||||...|......:
Human   198 IVECHGNTLLPQFLGMYRLTV----DGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEK 258

  Fly  1681 QGEIVLLDENLVQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLVGL---------- 1735
            ..::....:|.. ::..:.|:|...||....:.::||..||.:..:||||||||:          
Human   259 AKDLPTFKDNDF-LNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEE 322

  Fly  1736 -------------------------------------------------------------DKKN 1739
                                                                         ..|.
Human   323 MEVEERAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKK 387

  Fly  1740 GVLVLGIIDYIRTFTLDKRVESIIKGSGILGGKGKDPTVVNPERYKQRFIDAM 1792
            .|..:.|||.:..:...|:.....|  .:..|.|.:.:.||||:|.:||.:.|
Human   388 EVYFMAIIDILTPYDTKKKAAHAAK--TVKHGAGAEISTVNPEQYSKRFNEFM 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 68/313 (22%)
PIP4K2BXP_011523628.1 PIPKc 39..443 CDD:238081 68/313 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.