DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and PIP5K1B

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_001362965.1 Gene:PIP5K1B / 8395 HGNCID:8995 Length:540 Species:Homo sapiens


Alignment Length:297 Identity:66/297 - (22%)
Similarity:112/297 - (37%) Gaps:79/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1564 SLCKSVQWE-ARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQQQQQPTLLA 1627
            |:|.....| :..|.|||.|..|.||.|::|.:..::....:...|.|:..::    |...|||.
Human   108 SICSEPLIELSNPGASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLN----QNPRTLLP 168

  Fly  1628 KIFGVFRVSVKKKDSFVERSVMVMENLF-YGCNIENKFDLKGSE-RNRLVDPSNQQGEIVLLDEN 1690
            |.:|::.:    :...:...::||.|:. ....:...:|||||. :.|......::......|.:
Human   169 KFYGLYCM----QSGGINIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLD 229

  Fly  1691 LVQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLVGLD------------------- 1736
            .:| ...:.||..:.:...|...:|||...||...:||||||:|:.                   
Human   230 FLQ-DMHEGLYFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETPQNVPD 293

  Fly  1737 -KKNG--------------------------------------------VLVLGIIDYIRTFTLD 1756
             |:.|                                            :|.:||||.::::.|.
Human   294 AKRTGMQKVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLM 358

  Fly  1757 KRVESIIKGSGILGGKGKDPTVVNPERYKQRFIDAMD 1793
            |::|...|.   |...|...:|..|..|..||:..|:
Human   359 KKLEHSWKA---LVYDGDTVSVHRPSFYADRFLKFMN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 66/297 (22%)
PIP5K1BNP_001362965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PIPKc_PIP5K1B 27..400 CDD:340444 66/297 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.