DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and PIP5K1A

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:XP_006711626.1 Gene:PIP5K1A / 8394 HGNCID:8994 Length:574 Species:Homo sapiens


Alignment Length:493 Identity:96/493 - (19%)
Similarity:159/493 - (32%) Gaps:155/493 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1364 PLGSIPIHVRETDLSSVIAYSLTSMDYQK----AIDEAEANSNAAHSSPQLKRKIPLAESVSDAE 1424
            |:.|..:..|:....|::.|: :.|..:|    ::|.:...:....:|..||..|.|        
Human    48 PMASEVLEARQDSYISLVPYA-SGMPIKKIGHRSVDSSGETTYKKTTSSALKGAIQL-------- 103

  Fly  1425 DSPSLSRTSSNTSAAPNASVPSPATAASESEEKSKERIKQPPSPHITLAFQDHSCQFQCKIYFAR 1489
               .::.|..:.|..|...|........||.....|.....|:.|    :.|    |:.|.|...
Human   104 ---GITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHH----YND----FRFKTYAPV 157

  Fly  1490 EFDAMRSK-SLKPPKLDKSLYRRLEKSKMREELRISQSRTGSEMELVRKPSDVGAPRTTEDDSNQ 1553
            .|...|.. .::|   |..||                       .|..:|               
Human   158 AFRYFRELFGIRP---DDYLY-----------------------SLCSEP--------------- 181

  Fly  1554 EEDARIALARSLCKSVQWEARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQ 1618
                    ...||.|       |.|||.|..:.||.|::|.:..::....:...|.|:..::   
Human   182 --------LIELCSS-------GASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLN--- 228

  Fly  1619 QQQQPTLLAKIFGVFRVSVKKKDSFVERSVMVMENLF-YGCNIENKFDLKGSERNRLVDPSNQQG 1682
             |...|||.|.:|::.|....|:.    .::||.||. ....:..|:|||||...|......::.
Human   229 -QNPRTLLPKFYGLYCVQAGGKNI----RIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREK 288

  Fly  1683 EIVLLDENLVQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLV-------------- 1733
            .:....:..........|::.:.....|...:|||...|:...:||||||:              
Human   289 PLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLS 353

  Fly  1734 -------------------------------------------GLDKKNG-----VLVLGIIDYI 1750
                                                       |:..:|.     :|.:||||.:
Human   354 SETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDIL 418

  Fly  1751 RTFTLDKRVESIIKGSGILGGKGKDPTVVNPERYKQRF 1788
            :::...|::|...|.   |...|...:|..|..|.:||
Human   419 QSYRFVKKLEHSWKA---LVHDGDTVSVHRPGFYAERF 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 85/440 (19%)
PIP5K1AXP_006711626.1 PIPKc 121..461 CDD:214623 79/408 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.