Sequence 1: | NP_611269.1 | Gene: | fab1 / 37033 | FlyBaseID: | FBgn0028741 | Length: | 1809 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001072498.1 | Gene: | zfyve28 / 779953 | XenbaseID: | XB-GENE-1219057 | Length: | 951 | Species: | Xenopus tropicalis |
Alignment Length: | 255 | Identity: | 61/255 - (23%) |
---|---|---|---|
Similarity: | 100/255 - (39%) | Gaps: | 66/255 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 NQSYNTVNDISSGSSSSSSTQPVQVVGKSQFFSDSQTSTA----EIADVETSSQSSVRPQPPTTL 108
Fly 109 SIRTNSETRGTSTSSNTAAED-----SETSDRVETLPLPTSEANQGRTVSNVLKHISNIVATKNN 168
Fly 169 ND-----------LRN---------------------YKDTELQ--RFWMPDSKAKECYDCSQKF 199
Fly 200 STFRRKHHCRLCGQIFCSKCCNQVVPGMIIRCDGDLK---VCNYCSKIVLTFLKSSSSEM 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fab1 | NP_611269.1 | FYVE_PIKfyve_Fab1 | 182..243 | CDD:277264 | 26/63 (41%) |
DEP | 329..397 | CDD:214489 | |||
Fab1_TCP | 464..717 | CDD:239450 | |||
PIPKc | 1413..1797 | CDD:295374 | |||
zfyve28 | NP_001072498.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 360..382 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 527..557 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 641..726 | 1/8 (13%) | |||
FYVE_LST2 | 874..938 | CDD:277270 | 26/66 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2108 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |