DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and Rufy2

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_081701.2 Gene:Rufy2 / 70432 MGIID:1917682 Length:606 Species:Mus musculus


Alignment Length:291 Identity:58/291 - (19%)
Similarity:108/291 - (37%) Gaps:73/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLTEFARNFEDKPESLFG--RVVNKIQNVYNQSYNTVNDISSGSSSSSS---------------- 66
            ||.|  ::..:|.::|.|  :.:.:::.:..:.|..:.....|....:.                
Mouse   334 KLLE--KDIHEKQDTLIGLRQQLEEVKAINIEMYQRLQGSEDGLKEKNEIIARLEEKTNKITTAM 396

  Fly    67 ---TQPVQVVGKSQFFSDSQTS--TAEIADVETSSQSSVRPQPPTTLSIRTN----SETRGTSTS 122
               .|.:|...|:|..::::..  ..|......|.|..:..:....:.:.|:    .|.|.|...
Mouse   397 RQLEQRLQQAEKAQKEAEAEDEKYAQECLSQSDSLQRQISQKEQQLVQLETDLKIEKEWRQTLQE 461

  Fly   123 SNTAAEDSETSDRVETLPLPTSEANQGRTVSNVLKHISNIVATKNNNDLRNYKDTE--LQRF--- 182
            .....:|..:..|.||           :.|.::.|...|: ..:|....|.|::.|  ||..   
Mouse   462 DLQKEKDVLSHLRHET-----------QKVISLKKEFLNL-QDENQQLKRIYQEQEQALQELGSK 514

  Fly   183 ----------------------WMPDSKAKECYDCSQKFSTFRRKHHCRLCGQIFCSKCCNQVVP 225
                                  |:.|..|..|..|.::||..:||||||.||:|||:.|.:..:|
Mouse   515 LCESKLKIDDIKEANKALQGLVWLKDKDATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELP 579

  Fly   226 GMIIRCDGDLKVCNYCSKIVLTFLKSSSSEM 256
              :......::||:.|..::   ::..||.|
Mouse   580 --LPSSPKPVRVCDSCHAML---IQRCSSNM 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264 23/85 (27%)
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374
Rufy2NP_081701.2 RUN 45..168 CDD:280855
Taxilin 209..535 CDD:286771 32/214 (15%)
DUF972 223..>295 CDD:283750
GBP_C <326..510 CDD:303769 31/189 (16%)
coiled coil 497..507 CDD:293879 3/9 (33%)
FYVE_RUFY2 534..604 CDD:277298 24/74 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2108
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.