DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and pip5k1ba

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:XP_005155628.1 Gene:pip5k1ba / 449831 ZFINID:ZDB-GENE-041010-81 Length:529 Species:Danio rerio


Alignment Length:289 Identity:68/289 - (23%)
Similarity:111/289 - (38%) Gaps:73/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1564 SLCKSVQWE-ARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQQQQQPTLLA 1627
            |:||....| :..|.|.|.|..|.||.|::|.:..::....:...|.|:..::    |...|||.
Zfish   116 SICKEPLIELSNPGASSSWFYLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLN----QNPRTLLP 176

  Fly  1628 KIFGVFRVSVKKKDSFVERSVMVMENLF-YGCNIENKFDLKGSE-RNRLVDPSNQQGEIVLLDEN 1690
            |.:|::.:..    ..:...::||.|:. ....::.|:|||||. :.|.......:......|.:
Zfish   177 KFYGLYCIQC----GGMTIRLVVMNNVLPRSLKMDYKYDLKGSTYKRRASRKERAKSSPTFKDLD 237

  Fly  1691 LVQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLVG---LDKK-------------- 1738
            ..:|  .:.||..:.:...|...:|||...||...:||||||:|   ||::              
Zfish   238 FQEM--HEGLYFDADTYNALMKTLQRDCRVLESFKIMDYSLLLGIHVLDRRIRRGGRGDSRRQGT 300

  Fly  1739 ------------------------------NGV----------LVLGIIDYIRTFTLDKRVESII 1763
                                          .|:          :.|||||.::::...|:||...
Zfish   301 QKVLYSTARESIQGDGKAPEPVADADDETLGGIPAKHKDEKLLIFLGIIDILQSYRFIKKVEHSW 365

  Fly  1764 KGSGILGGKGKDPTVVNPERYKQRFIDAM 1792
            |.   |...|...:|..|..|..||:..|
Zfish   366 KA---LVHDGDTVSVHRPNFYADRFLKFM 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 68/289 (24%)
pip5k1baXP_005155628.1 PIPKc 61..395 CDD:214623 68/289 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.