DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and CCT1

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_524450.2 Gene:CCT1 / 42649 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster


Alignment Length:396 Identity:76/396 - (19%)
Similarity:134/396 - (33%) Gaps:114/396 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1233 LAESIELWGPRLQEIEKLTAKQAHHIDSGTICTEELRP---EQVQTADSSKVTTSSLPKEND--- 1291
            ||..:.:.|.|.......|......:....|....|.|   :::...|...||.:     ||   
  Fly     4 LASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVT-----NDGAT 63

  Fly  1292 -----PLECPS----------EDTETGASNSQTVLDKNFSIDQMLASTVNVYSDKKSIRKILTQL 1341
                 .:|.|:          :|.|.|...:..|:         ||:.:...:|:...:||....
  Fly    64 ILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVI---------LAAELLKNADELVKQKIHPTS 119

  Fly  1342 LPSGNQVNPLQSPFPAQDHLTLPLGSIP----IHVRETDLSSVI--------------------- 1381
            :.||.::...::.....:|||.|:..:.    |::.:|.:||.|                     
  Fly   120 IISGYRIACKEACKYISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKI 184

  Fly  1382 -------AYSLTSMDYQKAIDEAEANS--------NAAHSSPQLKRKIPLAE-SVSDAEDSPSLS 1430
                   |||:.:::..||..::...|        |...:|.|:.:||..|: :..|.    ||.
  Fly   185 TDPRGQAAYSIKAINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDF----SLQ 245

  Fly  1431 RTSSNTSAAPNASVPSPATAASESE-EKSKERIKQPPSPHITLAFQDHSCQFQCKIYFAREFDAM 1494
            :|..........:.|....|....| :.:||||.......:.:..........|..||. |..||
  Fly   246 KTKMKMGVQVLINDPDKLEAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFV-EAGAM 309

  Fly  1495 RSKSLKPPKLDKSLYRRLEKSKMREELRISQSRTGS---------------EMELVRKPSDVGAP 1544
                         ..||::||    :|:|....||:               :..:|.:.::|...
  Fly   310 -------------AVRRVKKS----DLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQE 357

  Fly  1545 RTTEDD 1550
            |..:|:
  Fly   358 RICDDE 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 32/155 (21%)
CCT1NP_524450.2 TCP1_alpha 12..538 CDD:239451 74/388 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.