DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and Pip5k1a

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:XP_038958707.1 Gene:Pip5k1a / 365865 RGDID:1306127 Length:561 Species:Rattus norvegicus


Alignment Length:289 Identity:63/289 - (21%)
Similarity:106/289 - (36%) Gaps:75/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1564 SLCKSVQWE-ARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQQQQQPTLLA 1627
            |||.....| :..|.|||.|..:.||.|::|.:..::....:...|.|:..::    |...|||.
  Rat   163 SLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLN----QNPRTLLP 223

  Fly  1628 KIFGVFRVSVKKKDSFVERSVMVMENLF-YGCNIENKFDLKGSERNRLVDPSNQQGEIVLLDENL 1691
            |.:|::.|....|:.    .::||.||. ....:..|:|||||...|......::..:....:..
  Rat   224 KFYGLYCVQAGGKNI----RIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLD 284

  Fly  1692 VQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLV----------------------- 1733
            ........|::.:...:.|...:|||...|:...:||||||:                       
  Rat   285 FLQDIPDGLFLDADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPMNSETQYSIDT 349

  Fly  1734 ----------------------------------GLDKKNG-----VLVLGIIDYIRTFTLDKRV 1759
                                              |:..:|.     :|.:||||.::::...|::
  Rat   350 RRPAPQKALYSTAMESIQGEARRGGTVETEDHMGGIPARNNKGERLLLYIGIIDILQSYRFVKKL 414

  Fly  1760 ESIIKGSGILGGKGKDPTVVNPERYKQRF 1788
            |...|.   |...|...:|..|..|.:||
  Rat   415 EHSWKA---LVHDGDTVSVHRPGFYAERF 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 63/289 (22%)
Pip5k1aXP_038958707.1 PIPKc_PIP5K1A_like 79..454 CDD:340443 63/289 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.