DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and CCT4

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_609579.1 Gene:CCT4 / 34674 FlyBaseID:FBgn0032444 Length:533 Species:Drosophila melanogaster


Alignment Length:526 Identity:118/526 - (22%)
Similarity:195/526 - (37%) Gaps:146/526 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 DDRKNILQQSNSLITLHEEMQRDLPAQNCGQRLIEFLNSNNKSANE--VQAVAILNAMLAAGFLE 378
            :|...||:|.|   .||       ||   .:.|:|...:.:.:|.:  ...|.|..|:|.|  .|
  Fly    65 NDGATILKQMN---VLH-------PA---AKMLVELSRAQDVAAGDGTTSVVVIAGALLEA--CE 114

  Fly   379 PIVPDPEQMDFDSSLHYKFSKSSSSDTSRTMSPQFEANPHAEPQPPKSMDQSAEEKEKELENELE 443
            .::        ...||    .::.||:.:..|                  ..|.|..|::...:|
  Fly   115 KLL--------QKGLH----PTAISDSFQRCS------------------NKAVEILKQMSTPIE 149

  Fly   444 NDRCYT---TATSKLLASYCEHEEQLLAQMLRAHNLDQEWDKVLQMLCSTAANHFKP-EHCSNDL 504
            .|...|   :|::.|.:.....:..|||.:        ..|.||::.        .| :..|.||
  Fly   150 LDDRETLIKSASTSLNSKVVSQQSSLLAPI--------AVDAVLKVT--------DPGKETSVDL 198

  Fly   505 MDIRNYVNFKKVPGGRRKDSKIVHGVAFSKNVAHKDMATHVPFPRILLLQCPIV-------YERI 562
            .:|:...:.    ||..:|:::|.|:.|:...|..:....:...:|.|:|..|.       :..|
  Fly   199 KNIKVISSL----GGTVEDTELVDGLVFTCRSAGSNAPKRIEKAKIGLIQFCISAPKTDMDHNVI 259

  Fly   563 EGKFVTIETVLLQEKEYLRNVCARIMSFKPNVVLVHKN-----VAGIAQDLLRSYEVTLVLDVKL 622
            ...:..::.||.:|:.|:.|:..:|.....||:||.|:     |:.:||..|...:..:|.||:.
  Fly   260 VSDYAAMDRVLKEERSYILNIVKQIKKSGCNVLLVQKSILRDAVSDLAQHFLDKIKCMVVKDVER 324

  Fly   623 SVMERLSRTLQCDIVSSIESNITMPKLGYCNDFYIRNYNGKTLM--------FFEKLTN----PR 675
            ..:|.:.:||.|..::|::            .|...|.:...|:        .|.|:|.    .|
  Fly   325 EDIEFVCKTLHCRPIASLD------------HFTAENLSSADLVEEVASGTNKFVKITGIQNMGR 377

  Fly   676 GYTCLLRGGSNAELTRVKR-VASALLFARYNWRL------------EMSFLLNEFAQPLSPKP-- 725
            ..:.:.||.:...|....| :..||...|...:|            ||:..|...||.:....  
  Fly   378 TVSIICRGSNKLVLEEAARSLHDALCVVRCLVKLRAQIVGGGAPEIEMALQLAALAQTVEGVDAY 442

  Fly   726 ---SIFDSKETSPKT----------ETEAELRS------KRPIILERKSEDKITTIVSENVSDFT 771
               :..|:.|..|.|          .|..|||:      |...|..||.  .||.|.:|||   .
  Fly   443 CFRAFADALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKG--AITDIFAENV---V 502

  Fly   772 DPLRAS 777
            .||..|
  Fly   503 QPLLVS 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489 15/69 (22%)
Fab1_TCP 464..717 CDD:239450 64/290 (22%)
PIPKc 1413..1797 CDD:295374
CCT4NP_609579.1 TCP1_delta 18..531 CDD:239454 118/526 (22%)
Cpn60_TCP1 37..529 CDD:278544 118/526 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.