DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and CCT6

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_573066.1 Gene:CCT6 / 32518 FlyBaseID:FBgn0027329 Length:533 Species:Drosophila melanogaster


Alignment Length:400 Identity:81/400 - (20%)
Similarity:138/400 - (34%) Gaps:68/400 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 IEFLNSNNKSANEVQAVAILNAMLAAGFLEPIVPDPEQMDFDSSLHYKFSKSSSSDTSRTMSPQF 413
            |..||...:.|...||:|| |...|.|     :.|..:.:.......|...|.:.|...|.....
  Fly     4 ISLLNPKAEFARAAQALAI-NISAAKG-----LQDVMRTNLGPKGTVKMLVSGAGDIKITKDGNV 62

  Fly   414 EANPHAEPQPPKSMDQSAEEKEKELENELENDRCYTTATSKLLASYCEHEEQLLAQMLR----AH 474
            ..:......|..||...|...:.:...:      .||.|..|:....:..:..|::.|.    ..
  Fly    63 LLHEMQIQHPTASMIARASTAQDDSTGD------GTTTTVMLIGELLKQADIYLSEGLHPRIMTD 121

  Fly   475 NLDQEWDKVLQM--------------LCSTAANHFKPE-H----------CSNDLMDIR------ 508
            ..::..||.|::              |...|....|.: |          |.|.::.|.      
  Fly   122 GFEKARDKALEVLDQVKVPVEINKKNLVEVANTSLKTKVHPALADLLTDVCVNAVLTIASADKTK 186

  Fly   509 ----NYVNFKKVPGGRRKDSKIVHGVAFSKNVAHKDMATHVPFPRILLLQCPIVYERIE---GKF 566
                :.|...::......|:::|.|:.......|.||...:....||.....:.||:.|   |.|
  Fly   187 PVDLHMVELMEMQHKSDTDTQLVRGLVMDHGARHPDMPKRLENAYILTANVSLEYEKAEVNSGFF 251

  Fly   567 VTI----ETVLLQEKEYLRNVCARIMSFKPNV--------VLVH-KNVAGIAQDLLRSYEVTLVL 618
            ...    |..:..|:|::.....:::..|.:|        ||:: |.:..|:.|.|....:..:.
  Fly   252 YKTAEEREAFVRAEREFIDQRVKKVIELKRSVCDGTDKTFVLINQKGIDPISLDALAKEGILALR 316

  Fly   619 DVKLSVMERLSRTLQCDIVSSIESNITMPKLGYCNDFYIRNYNGKTLMFFEKLTNPRGYTCLLRG 683
            ..|...|||||.......::|.: ::....|||....|..........|.|...||...|.|::|
  Fly   317 RAKRRNMERLSLACGGTAMNSFD-DLQEEHLGYAGVVYEHVLGENKYTFVEDCKNPLSVTILIKG 380

  Fly   684 GSNAELTRVK 693
            .:...:|::|
  Fly   381 PNKHTITQIK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489 12/47 (26%)
Fab1_TCP 464..717 CDD:239450 56/284 (20%)
PIPKc 1413..1797 CDD:295374
CCT6NP_573066.1 chap_CCT_zeta 3..532 CDD:274088 80/399 (20%)
TCP1_zeta 7..528 CDD:239458 79/396 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.