DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and SPBC9B6.03

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_595745.1 Gene:SPBC9B6.03 / 2540208 PomBaseID:SPBC9B6.03 Length:293 Species:Schizosaccharomyces pombe


Alignment Length:271 Identity:63/271 - (23%)
Similarity:99/271 - (36%) Gaps:56/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QSYNTVNDISSGSSSSSSTQPVQVVGKSQFFSDSQTSTAEIADVETSSQSSVRPQPPTTLSIRTN 113
            |:.|....:|...:|||::.|.           :|.|.....:.:..|..:.:.:|....|...|
pombe    42 QATNGTGSVSGSPNSSSNSTPA-----------NQGSLPSHTNPQLYSSITRKERPELFRSYSGN 95

  Fly   114 SETRGTSTSSNTAAEDSETSDRVETLPLPTSEANQGRTVSNVLKHISNIVATKNNNDLRNYKDTE 178
            ........||..||.....|.:..:..:..:..|..             |||..|  .::.::|.
pombe    96 PRLSKPYASSKLAASSRTASYQAMSYSVSPTSTNSS-------------VATSLN--YQSSRETG 145

  Fly   179 LQR-FWMPDSKAKECY--DCSQKFSTFRRKHHCRLCGQIFCSKCCNQVVPGMIIRCDGDLKVC-- 238
            :.: .|.|||....|.  .||.:|..|.|:||||.||.|||:..|::.:|..:     |:|.|  
pombe   146 ISKDHWKPDSDVSVCSFPSCSVRFGLFDRRHHCRRCGDIFCALHCDRNIPLTM-----DVKFCLA 205

  Fly   239 ----NYCSKIVLTFLKSSSSEMGQDMQELQQHLSNKLEVQDS---GSSLAKHPQMQ-----RAPL 291
                ..|......:||..        |.:....||.:.|.:|   ......||..|     ..|:
pombe   206 GSLYRSCVSCFYEYLKWK--------QSIDLASSNDITVIESTIAPQQATTHPPSQPKNAVSVPI 262

  Fly   292 PRKTSVGYQEE 302
            |:..|...:.|
pombe   263 PKMDSTDSKGE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264 25/68 (37%)
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374
SPBC9B6.03NP_595745.1 FYVE_scVPS27p_Vac1p_like 159..216 CDD:277275 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2108
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.