DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and Pip4k2a

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:NP_032871.3 Gene:Pip4k2a / 18718 MGIID:1298206 Length:405 Species:Mus musculus


Alignment Length:304 Identity:73/304 - (24%)
Similarity:127/304 - (41%) Gaps:80/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1554 EEDARIALARSLCKSVQWEARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQ 1618
            ::|.:.:|.||.......:||   ||:||..:.|.|:|:|.:.|.|:........||.:||..| 
Mouse   109 DQDFQNSLTRSAPLPNDSQAR---SGARFHTSYDKRYVIKTITSEDVAEMHNILKKYHQYIVEC- 169

  Fly  1619 QQQQPTLLAKIFGVFRVSVKKKDSFVERSVMVMENLF-YGCNIENKFDLKGSERNRLVDPSNQQG 1682
              ...|||.:..|::|::|    ..||..|:|..|:| :..::..|:|||||...|......:..
Mouse   170 --HGVTLLPQFLGMYRLNV----DGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAK 228

  Fly  1683 EIVLLDENLVQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLVGL------------ 1735
            |:..|.:|.. ::..:.:|:..::|.:..:.:::|..||.:..:||||||||:            
Mouse   229 ELPTLKDNDF-INEGQKIYIDDNNKKIFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVE 292

  Fly  1736 -DKKNG-----------------------------------------------------VLVLGI 1746
             ::.:|                                                     |..:.|
Mouse   293 CEENDGEEEGESDSTHPIGTPPDSPGNTLNSSPPLAPGEFDPNIDVYAIKCHENAPRKEVYFMAI 357

  Fly  1747 IDYIRTFTLDKRVESIIKGSGILGGKGKDPTVVNPERYKQRFID 1790
            ||.:..:...|:.....|  .:..|.|.:.:.||||:|.:||:|
Mouse   358 IDILTHYDAKKKAAHAAK--TVKHGAGAEISTVNPEQYSKRFLD 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 73/304 (24%)
Pip4k2aNP_032871.3 Required for interaction with PIP5K1A. /evidence=ECO:0000250|UniProtKB:Q8TBX8 59..65
PIPKc 62..405 CDD:214623 73/304 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..328 1/39 (3%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.