Sequence 1: | NP_611269.1 | Gene: | fab1 / 37033 | FlyBaseID: | FBgn0028741 | Length: | 1809 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497500.1 | Gene: | ppk-2 / 175344 | WormBaseID: | WBGene00004088 | Length: | 401 | Species: | Caenorhabditis elegans |
Alignment Length: | 284 | Identity: | 60/284 - (21%) |
---|---|---|---|
Similarity: | 119/284 - (41%) | Gaps: | 79/284 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 1578 SGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQQQQQPTLLAKIFGVFRVSVKKKDS 1642
Fly 1643 FVERSVMVMENLF---YGCNIENKFDLKGSERNRLVDPSNQQGEI-VLLDENLVQMSWSKPLYVL 1703
Fly 1704 SHSKTVLRDAIQRDSSFLEKNLVMDYSLLVGLD-------------------------------- 1736
Fly 1737 -------------------------------KKNGVLVLGIIDYIRTFTLDKRVESIIKGSGILG 1770
Fly 1771 GKGKDPTVVNPERYKQRFIDAMDR 1794 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fab1 | NP_611269.1 | FYVE_PIKfyve_Fab1 | 182..243 | CDD:277264 | |
DEP | 329..397 | CDD:214489 | |||
Fab1_TCP | 464..717 | CDD:239450 | |||
PIPKc | 1413..1797 | CDD:295374 | 60/284 (21%) | ||
ppk-2 | NP_497500.1 | PIPKc_PIP5KII | 30..398 | CDD:340442 | 59/282 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5253 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |