Sequence 1: | NP_611269.1 | Gene: | fab1 / 37033 | FlyBaseID: | FBgn0028741 | Length: | 1809 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_473392.1 | Gene: | Pip4k2b / 108083 | MGIID: | 1934234 | Length: | 416 | Species: | Mus musculus |
Alignment Length: | 289 | Identity: | 69/289 - (23%) |
---|---|---|---|
Similarity: | 113/289 - (39%) | Gaps: | 82/289 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 1576 GKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQQQQQPTLLAKIFGVFRVSVKKK 1640
Fly 1641 DSFVERSVMVMENLF-YGCNIENKFDLKGSERNRLVDPSNQQGEIVLLDENLVQMSWSKPLYVLS 1704
Fly 1705 HSKTVLRDAIQRDSSFLEKNLVMDYSLLVGL---DK----------------------------- 1737
Fly 1738 ---------------------------------------KNGVLVLGIIDYIRTFTLDKRVESII 1763
Fly 1764 KGSGILGGKGKDPTVVNPERYKQRFIDAM 1792 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fab1 | NP_611269.1 | FYVE_PIKfyve_Fab1 | 182..243 | CDD:277264 | |
DEP | 329..397 | CDD:214489 | |||
Fab1_TCP | 464..717 | CDD:239450 | |||
PIPKc | 1413..1797 | CDD:295374 | 69/289 (24%) | ||
Pip4k2b | NP_473392.1 | PIPKc_PIP5K2B | 30..413 | CDD:340447 | 69/289 (24%) |
Required for interaction with PIP5K1A. /evidence=ECO:0000250|UniProtKB:Q8TBX8 | 64..70 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5253 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |