DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and pip4k2cb

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:XP_003199456.1 Gene:pip4k2cb / 100535634 ZFINID:ZDB-GENE-141212-236 Length:416 Species:Danio rerio


Alignment Length:411 Identity:85/411 - (20%)
Similarity:146/411 - (35%) Gaps:130/411 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1464 QPPSPHITLAFQDHSCQFQCKIYFAREFDAMRSKSLKPPKLDKSLYRRLEKSKMREELRISQSRT 1528
            |.|.| :.|...|.....:.|:.     :.:.:|...|.......|..|....:||  |......
Zfish    56 QVPMP-VMLLPDDFKANIKMKVN-----NHLFNKENLPGHFKFKEYCPLVFRNLRE--RFGVEHQ 112

  Fly  1529 GSEMELVRKPSDVGAPRTTEDDSNQEEDARIALARSLCKSVQWEARGGKSGSRFCKTLDDRFVLK 1593
            ..::.|.|.|       ..:||  :||:|.:.|                     .|:.|...::|
Zfish   113 DYQVSLTRSP-------PVKDD--KEEEAVLLL---------------------LKSYDRTLIVK 147

  Fly  1594 EMNSRDMTIFEPFAPKYFEYIDRCQQQQQPTLLAKIFGVFRVSVKKKDSFVERSVMVMENLF-YG 1657
            :::|.::........:|.::|..|...   |||.:..|::||:|..:|::    ::||.|:| :.
Zfish   148 QISSEEVEDMHNILSEYHQHIVTCHGS---TLLPQFLGMYRVTVDNEDTY----LLVMRNMFSHR 205

  Fly  1658 CNIENKFDLKGSERNRLVDPSNQQGEIVLLDE----NLVQMSWSKPLYVLSHSKTVLRDAIQRDS 1718
            ..|..|:|||||..:|......:..|:....:    |.:|.     :|:....|..|.|.:.||.
Zfish   206 LTIHRKYDLKGSLVSREASDKEKVKELPTFKDVDFRNNMQR-----VYISDEEKEKLLDKLNRDV 265

  Fly  1719 SFLEKNLVMDYSLLVGL-----------------------DKKNG-------------------- 1740
            .||.:..:||||||:|:                       |.:|.                    
Zfish   266 EFLVRLKIMDYSLLLGIHDVGRAEQEEEEEMKDSLSEEEEDSENDLHLPAVGSFGTSPEGIAGYM 330

  Fly  1741 ------------------------------VLVLGIIDYIRTFTLDKRVESIIKGSGILGGKGKD 1775
                                          |..:|:||.:..:...||.....|  .:..|.|.:
Zfish   331 SSYKALGPGEFDPFVDVYAIQSVDGAPCREVYFMGLIDILTQYDTKKRAAHAAK--TVKHGAGAE 393

  Fly  1776 PTVVNPERYKQRFIDAMDRYF 1796
            .:.|:||:|.:||.:.:...|
Zfish   394 ISTVHPEQYAKRFREFIANIF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 85/411 (21%)
pip4k2cbXP_003199456.1 PIPKc 64..414 CDD:214623 80/400 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.