DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and pip5kl1

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:XP_002935545.2 Gene:pip5kl1 / 100490940 XenbaseID:XB-GENE-986827 Length:504 Species:Xenopus tropicalis


Alignment Length:403 Identity:84/403 - (20%)
Similarity:147/403 - (36%) Gaps:125/403 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1365 LGSIPIHVRETDLSSVIAYSLTSMDYQKAIDEAEANSNAAH-----SSPQLKRKIPLAESVSDAE 1424
            :|.:..|..:   ::.|....::.|.::|:.|.|:..:..|     :..|..:.:.|.|...:.|
 Frog    42 VGQVLCHPLQ---AAEIPMEQSTKDEREAMPEGESRQSTRHRRLFWNLRQRWKLLGLFEIDQEHE 103

  Fly  1425 DSPSLSRTSSNTSAAPNASVPSPATAASESEEKSKERIKQPPSPHITLAFQDHSCQFQCKIYFAR 1489
            ..|                      ...:.::..|:.|::......|:|..|..  :..||....
 Frog   104 FYP----------------------LTCDLKQGLKQAIQESIHSDTTIALADEG--YSAKITQGH 144

  Fly  1490 EFDAMRSKSLKPPKLDKSLYRRLEKSKMREELRISQSRTGSEMELVRKPSDVGAPRTTEDDSNQE 1554
            |...||:            |.....|..|:.|.||:.                            
 Frog   145 EGFVMRT------------YAGPVFSHFRQSLGISEE---------------------------- 169

  Fly  1555 EDARIALARSL-CKSVQWE-ARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRC 1617
                 :..:|| |.....: ....||.:.|..|.|.||.||....|:.........:|.|:.   
 Frog   170 -----SFTKSLSCNEFYLQFISNSKSKADFFLTNDKRFFLKTQTKREAHFMLQILRRYIEHF--- 226

  Fly  1618 QQQQQPTLLAKIFGVFRVSV--KKKDSFVERSVMVMENLFY-GCNIENKFDLKGSERNRLVDPS- 1678
             |....:||.||.||:.::.  .||..|:     :|:::|: ...|.:::|:||.:.:|..:|. 
 Frog   227 -QLYPHSLLVKILGVYSITYAQNKKKYFI-----IMQSVFFPDERITSRYDIKGCKVSRWTEPEP 285

  Fly  1679 ------------NQQGEIVLLDENLVQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSL 1731
                        |.:|.::.||:   |.:|             |...::.|:|||::..|:||||
 Frog   286 EGSRVLQVFKDCNFEGNVICLDQ---QRAW-------------LLLQMELDASFLQQLNVIDYSL 334

  Fly  1732 LVGL-----DKKN 1739
            |||.     |:||
 Frog   335 LVGFQPLHADEKN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 75/350 (21%)
pip5kl1XP_002935545.2 PIPKc_PIP5KL1 102..502 CDD:340441 73/340 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.