DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fab1 and pip4k2b

DIOPT Version :9

Sequence 1:NP_611269.1 Gene:fab1 / 37033 FlyBaseID:FBgn0028741 Length:1809 Species:Drosophila melanogaster
Sequence 2:XP_002940195.1 Gene:pip4k2b / 100380045 XenbaseID:XB-GENE-979374 Length:418 Species:Xenopus tropicalis


Alignment Length:314 Identity:77/314 - (24%)
Similarity:127/314 - (40%) Gaps:83/314 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1554 EEDARIALARSLCKSVQWEARGGKSGSRFCKTLDDRFVLKEMNSRDMTIFEPFAPKYFEYIDRCQ 1618
            ::|.:.:|.||  ..|..|.: |:.||||..|.|.|||:|.::|.|:........||.::|..|.
 Frog   118 DQDYQNSLTRS--APVNSENQ-GRFGSRFLTTYDRRFVIKTISSEDVAEMHNILKKYHQFIVECH 179

  Fly  1619 QQQQPTLLAKIFGVFRVSVKKKDSFVERSVMVMENLF-YGCNIENKFDLKGSERNRLVDPSNQQG 1682
            ..   |||.:..|::|::|    ..||..::|..|:| :...:..|:|||||..:|......:..
 Frog   180 GN---TLLPQFLGMYRLTV----DGVETYMVVTRNVFSHRLGVHRKYDLKGSTVSREASDKEKAK 237

  Fly  1683 EIVLLDENLVQMSWSKPLYVLSHSKTVLRDAIQRDSSFLEKNLVMDYSLLVGL---DK------- 1737
            ::....:|.. ::..:.|:|...:|.:..:.::||..||....:|||||||||   |:       
 Frog   238 DLPTFKDNDF-LNEGQKLHVGEENKKIFLEKLKRDVEFLSVLKIMDYSLLVGLHDVDRAEQEEME 301

  Fly  1738 -----------------------------------------------------------KNGVLV 1743
                                                                       |..|..
 Frog   302 VEERAEEEECEDSSGNPICSYGTPPDSPGNLLNFPRFFGPGEFDPSVDVYAMKSHDSAPKKEVYF 366

  Fly  1744 LGIIDYIRTFTLDKRVESIIKGSGILGGKGKDPTVVNPERYKQRFIDAMDRYFL 1797
            :.|||.:..:...|:.....|  .:..|.|.:.:.||||:|.:|||:.|....:
 Frog   367 MAIIDILTPYDAKKKAAHAAK--TVKHGAGAEISTVNPEQYSKRFIEFMSNILM 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fab1NP_611269.1 FYVE_PIKfyve_Fab1 182..243 CDD:277264
DEP 329..397 CDD:214489
Fab1_TCP 464..717 CDD:239450
PIPKc 1413..1797 CDD:295374 77/312 (25%)
pip4k2bXP_002940195.1 PIPKc_PIP5K2B 34..415 CDD:340447 77/309 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.