DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18635 and xkr8

DIOPT Version :10

Sequence 1:NP_611267.1 Gene:CG18635 / 37031 FlyBaseID:FBgn0034279 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_012812573.2 Gene:xkr8 / 619360 XenbaseID:XB-GENE-940182 Length:566 Species:Xenopus tropicalis


Alignment Length:62 Identity:16/62 - (25%)
Similarity:33/62 - (53%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 TSNIELLLFVQAYAQAAPQIILQLYHMLVQDMFRNYETSAVQSLSLVFSAIDLAAITTSYHR 211
            |.:|.::..::.:.:..||:||.||.:|.:.....::   ..|:|:.|.:|..|.:  .||:
 Frog   302 THDISMMRLMETFLENTPQLILLLYIVLHRGTIYTFQ---YFSISISFISISWAIL--DYHQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18635NP_611267.1 XK-related 34..>211 CDD:462912 15/60 (25%)
XK-related <483..623 CDD:462912
xkr8XP_012812573.2 XK-related <266..518 CDD:462912 16/62 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.