DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18635 and CG32579

DIOPT Version :10

Sequence 1:NP_611267.1 Gene:CG18635 / 37031 FlyBaseID:FBgn0034279 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster


Alignment Length:195 Identity:38/195 - (19%)
Similarity:80/195 - (41%) Gaps:22/195 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TCLGLLVYIVQTASDLALSYQHFRQKEPTLGAGTLVLVILPPVIT---FILVAASKEQRECACSE 95
            |.:.:|...|....:.:|:|.::.::.....|.|:..:::|.|:|   :|....|....|....|
  Fly    26 TVVSILWRFVSICINWSLAYVYWMEESYGYCAWTIGSILVPMVVTSVIYIHTLKSAHAGEKRILE 90

  Fly    96 R----NKCVALGIGLLKLFLFPFFVIFRFCTRLFWAIEGLFHDDDDVERMKCLAKATQTSNIELL 156
            |    |..::        :||....:..:..:...|.|   .||...|........|:..|:..:
  Fly    91 RGVYSNAVIS--------YLFRDVYVLNYAFKYSLAKE---RDDKQAEIEYYQKLMTEECNVSFV 144

  Fly   157 LFVQAYAQAAPQIILQLYHMLVQDMFRNYETSAVQSLSLVFSAIDLAAITTSYHRIESQRRVGRH 221
            ....::.::|||.||||..:|...:    |.:..:.::|:....::|....:|:......::.:|
  Fly   145 RLFDSFLESAPQKILQLAILLQSTL----EFTYYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKH 205

  Fly   222  221
              Fly   206  205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18635NP_611267.1 XK-related 34..>211 CDD:462912 37/183 (20%)
XK-related <483..623 CDD:462912
CG32579NP_001259606.1 XK-related 25..352 CDD:462912 38/195 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.