DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18635 and Xkr6

DIOPT Version :10

Sequence 1:NP_611267.1 Gene:CG18635 / 37031 FlyBaseID:FBgn0034279 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_775569.2 Gene:Xkr6 / 219149 MGIID:2447765 Length:638 Species:Mus musculus


Alignment Length:166 Identity:37/166 - (22%)
Similarity:66/166 - (39%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 QDD-----FAGRTVSFFGWIAFITMRMLSLSTFCVFYPKAFFILVGVHYALMLGCL--ALETRCR 533
            :||     :.|..:..|..:..|:.|::|.:.|...:...|.|.|.||:..|...:  .....|.
Mouse   343 RDDKKSMSYRGALIHLFWRLFTISSRVISFALFASIFQLYFGIFVVVHWCAMAFWIIHGGTDFCM 407

  Fly   534 GSWSRSLFLLLLAYIYIFVLMEFRVSFKNIRLWYGGYLVLTLVENITISSIWYANEEFESW---- 594
            ..|...||.:::..:|||.....:......|::  .|..:.|.||..::.:||.....||.    
Mouse   408 SKWEEILFNMVVGIVYIFCWFNVKEGRTRYRMF--AYYTIVLTENAALTFLWYFYRNPESTDSYA 470

  Fly   595 -------WFGFIWEWIVYSGILFLATLIVYYCILRP 623
                   :..|:      :||   ..:::||.:|.|
Mouse   471 VPALCCVFVSFV------AGI---TLMLLYYGVLHP 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18635NP_611267.1 XK-related 34..>211 CDD:462912
XK-related <483..623 CDD:462912 33/152 (22%)
Xkr6NP_775569.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..117
XK-related 128..497 CDD:462912 36/164 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.