| Sequence 1: | NP_611267.1 | Gene: | CG18635 / 37031 | FlyBaseID: | FBgn0034279 | Length: | 649 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_443130.1 | Gene: | XKR4 / 114786 | HGNCID: | 29394 | Length: | 650 | Species: | Homo sapiens |
| Alignment Length: | 50 | Identity: | 16/50 - (32%) |
|---|---|---|---|
| Similarity: | 21/50 - (42%) | Gaps: | 1/50 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 152 LADCRSLLRSCVVRHLTDKSLGRIDEVFDTFADSALLETAFRQDSPYREI 201 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18635 | NP_611267.1 | XK-related | 34..>211 | CDD:462912 | 15/49 (31%) |
| XK-related | <483..623 | CDD:462912 | |||
| XKR4 | NP_443130.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..44 | ||
| XK-related | 114..515 | CDD:462912 | 10/41 (24%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 200..238 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||